Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.3: RWD domain [110843] (4 proteins) Pfam PF05773 |
Protein E3 ubiquitin-protein ligase RNF25 [160081] (1 species) RING finger protein 25 |
Species Human (Homo sapiens) [TaxId:9606] [160082] (2 PDB entries) Uniprot Q96BH1 10-125! Uniprot Q96BH1 10-134 |
Domain d2dmfa1: 2dmf A:8-131 [146547] Other proteins in same PDB: d2dmfa2, d2dmfa3 |
PDB Entry: 2dmf (more details)
SCOPe Domain Sequences for d2dmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmfa1 d.20.1.3 (A:8-131) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} eedwvlpsevevlesiyldelqvikgngrtspweiyitlhpataedqdsqyvcftlvlqv paeyphevpqisirnprglsdeqihtilqvlghvakaglgtamlyeliekgkeiltdnni phgq
Timeline for d2dmfa1: