Lineage for d2dmaa_ (2dma A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527763Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2527764Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2527765Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2527773Species Pyrococcus horikoshii [TaxId:53953] [160530] (2 PDB entries)
    Uniprot O57724 81-198
  8. 2527776Domain d2dmaa_: 2dma A: [146546]
    automated match to d2dm9a1

Details for d2dmaa_

PDB Entry: 2dma (more details), 2.05 Å

PDB Description: Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)
PDB Compounds: (A:) V-type ATP synthase subunit E

SCOPe Domain Sequences for d2dmaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmaa_ d.81.4.1 (A:) V-type ATPase subunit E C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
eiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasriee
ikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg

SCOPe Domain Coordinates for d2dmaa_:

Click to download the PDB-style file with coordinates for d2dmaa_.
(The format of our PDB-style files is described here.)

Timeline for d2dmaa_: