Lineage for d2dm9a1 (2dm9 A:81-198)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527763Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2527764Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2527765Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2527773Species Pyrococcus horikoshii [TaxId:53953] [160530] (2 PDB entries)
    Uniprot O57724 81-198
  8. 2527774Domain d2dm9a1: 2dm9 A:81-198 [146544]

Details for d2dm9a1

PDB Entry: 2dm9 (more details), 1.85 Å

PDB Description: Crystal Structure of PH1978 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) V-type ATP synthase subunit E

SCOPe Domain Sequences for d2dm9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm9a1 d.81.4.1 (A:81-198) V-type ATPase subunit E C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
eiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasriee
ikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg

SCOPe Domain Coordinates for d2dm9a1:

Click to download the PDB-style file with coordinates for d2dm9a1.
(The format of our PDB-style files is described here.)

Timeline for d2dm9a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dm9b_