Lineage for d2dl6a1 (2dl6 A:8-77)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958413Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958430Superfamily d.76.2: BRK domain-like [160481] (1 family) (S)
  5. 2958431Family d.76.2.1: BRK domain-like [160482] (2 proteins)
    Pfam PF07533; TCH domain
  6. 2958437Protein Chromodomain-helicase-dna-binding protein 8, CHD8 [160483] (1 species)
  7. 2958438Species Human (Homo sapiens) [TaxId:9606] [160484] (2 PDB entries)
    Uniprot Q9HCK8 2024-2093! Uniprot Q9HCK8 2028-2085
  8. 2958440Domain d2dl6a1: 2dl6 A:8-77 [146540]
    Other proteins in same PDB: d2dl6a2, d2dl6a3

Details for d2dl6a1

PDB Entry: 2dl6 (more details)

PDB Description: solution structure of the first brk domain from human chromodomain- helicase-dna-binding protein 8
PDB Compounds: (A:) chromodomain-helicase-DNA-binding protein 8

SCOPe Domain Sequences for d2dl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dl6a1 d.76.2.1 (A:8-77) Chromodomain-helicase-dna-binding protein 8, CHD8 {Human (Homo sapiens) [TaxId: 9606]}
epnhldvdletripvinkvdgtllvgedaprraelemwlqghpefavdprflaymedrrk
qkwqrckknn

SCOPe Domain Coordinates for d2dl6a1:

Click to download the PDB-style file with coordinates for d2dl6a1.
(The format of our PDB-style files is described here.)

Timeline for d2dl6a1: