SCOPe 2.01: Domain d2dkta2: 2dkt A:82-137

Lineage for d2dkta2 (2dkt A:82-137)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.93: Zinc hairpin stack [161244] (1 superfamily)
   stack of beta-hairpins; in the middle hairpins, there is HCxxCxxC motif, the first and the last residues of which contribute to the zinc-binding site on one side of hairpin, whereas the middle residues contribute to the zinc-binding site on the other side

4. Superfamily g.93.1: Zinc hairpin stack [161245] (1 family)

5. Family g.93.1.1: Zinc hairpin stack [161246] (1 protein)
   PfamB PB004087

6. Protein RING finger and CHY zinc finger domain-containing protein 1 [161247] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [161248] (1 PDB entry)
   Uniprot Q9CR50 83-138

8. Domain d2dkta2: 2dkt A:82-137 [146538]
   Other proteins in same PDB: d2dkta1
   complexed with zn

Details for d2dkta2

PDB Entry: 2dkt

PDB Description: solution structure of the chy zinc finger domain of the ring finger and chy zinc finger domain-containing protein 1 from mus musculus

PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2dkta2:

Sequence; same for both SEQRES and ATOM records:

>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
geyycsichlfdkdkrqyhcescgicrigpkedffhclkcnlclttnlrgkhkcie

Timeline for d2dkta2:

• d2dkta2 first appeared in SCOP 1.75
  
• d2dkta2 appears in SCOPe 2.02
  
• d2dkta2 appears in the current release, SCOPe 2.08