Lineage for d2dkta2 (2dkt A:82-137)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038966Fold g.93: Zinc hairpin stack [161244] (1 superfamily)
    stack of beta-hairpins; in the middle hairpins, there is HCxxCxxC motif, the first and the last residues of which contribute to the zinc-binding site on one side of hairpin, whereas the middle residues contribute to the zinc-binding site on the other side
  4. 3038967Superfamily g.93.1: Zinc hairpin stack [161245] (2 families) (S)
  5. 3038968Family g.93.1.1: Zinc hairpin stack [161246] (1 protein)
    PfamB PB004087
  6. 3038969Protein RING finger and CHY zinc finger domain-containing protein 1 [161247] (1 species)
  7. 3038970Species Mouse (Mus musculus) [TaxId:10090] [161248] (1 PDB entry)
    Uniprot Q9CR50 83-138
  8. 3038971Domain d2dkta2: 2dkt A:82-137 [146538]
    Other proteins in same PDB: d2dkta1, d2dkta3, d2dkta4
    complexed with zn

Details for d2dkta2

PDB Entry: 2dkt (more details)

PDB Description: solution structure of the chy zinc finger domain of the ring finger and chy zinc finger domain-containing protein 1 from mus musculus
PDB Compounds: (A:) RING finger and CHY zinc finger domain-containing protein 1

SCOPe Domain Sequences for d2dkta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
geyycsichlfdkdkrqyhcescgicrigpkedffhclkcnlclttnlrgkhkcie

SCOPe Domain Coordinates for d2dkta2:

Click to download the PDB-style file with coordinates for d2dkta2.
(The format of our PDB-style files is described here.)

Timeline for d2dkta2: