Lineage for d2dk8a1 (2dk8 A:8-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 763077Family a.4.5.85: RPO3F domain-like [158341] (1 protein)
    middle region of Pfam PF05158
  6. 763078Protein DNA-directed RNA polymerase III subunit RPC6, RPO3F [158342] (2 species)
  7. 763081Species Mouse (Mus musculus) [TaxId:10090] [158343] (1 PDB entry)
    Uniprot Q921X6 11-79
  8. 763082Domain d2dk8a1: 2dk8 A:8-75 [146535]

Details for d2dk8a1

PDB Entry: 2dk8 (more details)

PDB Description: solution structure of rpc34 subunit in rna polymerase iii from mouse
PDB Compounds: (A:) DNA-directed RNA polymerase III 39 kDa polypeptide

SCOP Domain Sequences for d2dk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dk8a1 a.4.5.85 (A:8-75) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Mouse (Mus musculus) [TaxId: 10090]}
pdadpveienriielchqfphgitdqviqnemphieaqqravainrllsmgqldllrsnt
gllyrikd

SCOP Domain Coordinates for d2dk8a1:

Click to download the PDB-style file with coordinates for d2dk8a1.
(The format of our PDB-style files is described here.)

Timeline for d2dk8a1: