Lineage for d2dk3a1 (2dk3 A:8-80)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394928Superfamily b.34.19: Mib/herc2 domain-like [159034] (1 family) (S)
  5. 2394929Family b.34.19.1: Mib/herc2 domain [159035] (1 protein)
    Pfam PF06701
  6. 2394930Protein E3 ubiquitin-protein ligase hectd1 [159036] (1 species)
  7. 2394931Species Human (Homo sapiens) [TaxId:9606] [159037] (2 PDB entries)
    Uniprot Q9ULT8 1268-1340
  8. 2394933Domain d2dk3a1: 2dk3 A:8-80 [146532]
    Other proteins in same PDB: d2dk3a2, d2dk3a3

Details for d2dk3a1

PDB Entry: 2dk3 (more details)

PDB Description: solution structure of mib-herc2 domain in hect domain containing protein 1
PDB Compounds: (A:) E3 ubiquitin-protein ligase HECTD1

SCOPe Domain Sequences for d2dk3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dk3a1 b.34.19.1 (A:8-80) E3 ubiquitin-protein ligase hectd1 {Human (Homo sapiens) [TaxId: 9606]}
vrsqvlkymvpgarvirgldwkwrdqdgspqgegtvtgelhngwidvtwdaggsnsyrmg
aegkfdlklapgy

SCOPe Domain Coordinates for d2dk3a1:

Click to download the PDB-style file with coordinates for d2dk3a1.
(The format of our PDB-style files is described here.)

Timeline for d2dk3a1: