Lineage for d2dira1 (2dir A:8-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616363Fold d.308: THUMP domain [143436] (1 superfamily)
    contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel
  4. 2616364Superfamily d.308.1: THUMP domain-like [143437] (3 families) (S)
    predicted RNA-binding function
  5. 2616378Family d.308.1.3: Minimal THUMP [160383] (1 protein)
    subfamily of Pfam PF02926; 4 stranded mixed beta-sheet with 2 helices on one side and a crossover loop on the other side
  6. 2616379Protein THUMP domain-containing protein 1 [160384] (1 species)
  7. 2616380Species Human (Homo sapiens) [TaxId:9606] [160385] (1 PDB entry)
    Uniprot Q9NXG2 170-254
  8. 2616381Domain d2dira1: 2dir A:8-92 [146528]
    Other proteins in same PDB: d2dira2, d2dira3

Details for d2dira1

PDB Entry: 2dir (more details)

PDB Description: solution structure of the thump domain of thump domain-containing protein 1
PDB Compounds: (A:) THUMP domain-containing protein 1

SCOPe Domain Sequences for d2dira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dira1 d.308.1.3 (A:8-92) THUMP domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
kafledmkkyaetflepwfkapnkgtfqivyksrnnshvnreevirelagivctlnsenk
vdltnpqytvvveiikavcclsvvk

SCOPe Domain Coordinates for d2dira1:

Click to download the PDB-style file with coordinates for d2dira1.
(The format of our PDB-style files is described here.)

Timeline for d2dira1: