SCOP 1.75: Domain d2dira1: 2dir A:8-92

Lineage for d2dira1 (2dir A:8-92)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.308: THUMP domain [143436] (1 superfamily)
   contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel

4. Superfamily d.308.1: THUMP domain-like [143437] (3 families)
   predicted RNA-binding function

5. Family d.308.1.3: Minimal THUMP [160383] (1 protein)
   subfamily of Pfam PF02926; 4 stranded mixed beta-sheet with 2 helices on one side and a crossover loop on the other side

6. Protein THUMP domain-containing protein 1 [160384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160385] (1 PDB entry)
   Uniprot Q9NXG2 170-254

8. Domain d2dira1: 2dir A:8-92 [146528]

Details for d2dira1

PDB Entry: 2dir

PDB Description: solution structure of the thump domain of thump domain-containing protein 1

PDB Compounds: (A:) THUMP domain-containing protein 1

SCOP Domain Sequences for d2dira1:

Sequence; same for both SEQRES and ATOM records:

>d2dira1 d.308.1.3 (A:8-92) THUMP domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
kafledmkkyaetflepwfkapnkgtfqivyksrnnshvnreevirelagivctlnsenk
vdltnpqytvvveiikavcclsvvk

Timeline for d2dira1:

• d2dira1 is new in SCOP 1.75
  
• d2dira1 appears in SCOPe 2.01
  
• d2dira1 appears in the current release, SCOPe 2.08