| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.308: THUMP domain [143436] (1 superfamily) contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel |
Superfamily d.308.1: THUMP domain-like [143437] (3 families) ![]() predicted RNA-binding function |
| Family d.308.1.3: Minimal THUMP [160383] (1 protein) subfamily of Pfam PF02926; 4 stranded mixed beta-sheet with 2 helices on one side and a crossover loop on the other side |
| Protein THUMP domain-containing protein 1 [160384] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [160385] (1 PDB entry) Uniprot Q9NXG2 170-254 |
| Domain d2dira1: 2dir A:8-92 [146528] |
PDB Entry: 2dir (more details)
SCOP Domain Sequences for d2dira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dira1 d.308.1.3 (A:8-92) THUMP domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}
kafledmkkyaetflepwfkapnkgtfqivyksrnnshvnreevirelagivctlnsenk
vdltnpqytvvveiikavcclsvvk
Timeline for d2dira1: