Lineage for d2dipa1 (2dip A:8-92)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642363Family g.44.1.6: ZZ domain [161211] (4 proteins)
    Pfam PF00569
  6. 2642367Protein Zinc finger ZZ-type-containing protein 2 [161214] (1 species)
  7. 2642368Species Human (Homo sapiens) [TaxId:9606] [161215] (1 PDB entry)
    Uniprot Q8NEG5 208-292
  8. 2642369Domain d2dipa1: 2dip A:8-92 [146527]
    Other proteins in same PDB: d2dipa2, d2dipa3
    complexed with zn

Details for d2dipa1

PDB Entry: 2dip (more details)

PDB Description: solution structure of the zz domain of zinc finger swim domain containing protein 2
PDB Compounds: (A:) Zinc finger SWIM domain-containing protein 2

SCOPe Domain Sequences for d2dipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}
leefknssklvaaaekerldkhlgipcnnckqfpiegkcykctecieyhlcqecfdsych
lshtftfrekrnqkwrslekradev

SCOPe Domain Coordinates for d2dipa1:

Click to download the PDB-style file with coordinates for d2dipa1.
(The format of our PDB-style files is described here.)

Timeline for d2dipa1: