![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.6: ZZ domain [161211] (4 proteins) Pfam PF00569 |
![]() | Protein Zinc finger ZZ-type-containing protein 2 [161214] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161215] (1 PDB entry) Uniprot Q8NEG5 208-292 |
![]() | Domain d2dipa1: 2dip A:8-92 [146527] Other proteins in same PDB: d2dipa2, d2dipa3 complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2dip (more details)
SCOPe Domain Sequences for d2dipa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} leefknssklvaaaekerldkhlgipcnnckqfpiegkcykctecieyhlcqecfdsych lshtftfrekrnqkwrslekradev
Timeline for d2dipa1: