Lineage for d2diob_ (2dio B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434089Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2434090Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 2434091Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 2434092Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 2434095Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 2434101Domain d2diob_: 2dio B: [146525]
    automated match to d1z8ka1
    complexed with eod, gol

Details for d2diob_

PDB Entry: 2dio (more details), 1.7 Å

PDB Description: Crystal Structure of the Allene Oxide Cyclase 2 with bound inhibitor vernolic acid
PDB Compounds: (B:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2diob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diob_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOPe Domain Coordinates for d2diob_:

Click to download the PDB-style file with coordinates for d2diob_.
(The format of our PDB-style files is described here.)

Timeline for d2diob_: