SCOPe 2.08: Domain d2diob_: 2dio B:

Lineage for d2diob_ (2dio B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
   Uniprot Q9LS02 80-253

8. Domain d2diob_: 2dio B: [146525]
   automated match to d1z8ka1
   complexed with eod, gol

Details for d2diob_

PDB Entry: 2dio, 1.7 Å

PDB Description: Crystal Structure of the Allene Oxide Cyclase 2 with bound inhibitor vernolic acid

PDB Compounds: (B:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2diob_:

Sequence; same for both SEQRES and ATOM records:

>d2diob_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2diob_:

• d2diob_ first appeared in SCOP 1.75, called d2diob1
  
• d2diob_ appears in SCOPe 2.07