SCOPe 2.06: Domain d2dioa_: 2dio A:

Lineage for d2dioa_ (2dio A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
   Uniprot Q9LS02 80-253

8. Domain d2dioa_: 2dio A: [146524]
   automated match to d1z8ka1
   complexed with eod, gol

Details for d2dioa_

PDB Entry: 2dio, 1.7 Å

PDB Description: Crystal Structure of the Allene Oxide Cyclase 2 with bound inhibitor vernolic acid

PDB Compounds: (A:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2dioa_:

Sequence; same for both SEQRES and ATOM records:

>d2dioa_ b.159.1.1 (A:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2dioa_:

• d2dioa_ first appeared in SCOP 1.75, called d2dioa1
  
• d2dioa_ appears in SCOPe 2.05
  
• d2dioa_ appears in SCOPe 2.07
  
• d2dioa_ appears in the current release, SCOPe 2.08