Lineage for d2difa1 (2dif A:8-47)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893784Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 893785Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) (S)
  5. 893786Family g.43.1.1: B-box zinc-binding domain [57846] (7 proteins)
  6. 893799Protein Tripartite motif-containing protein 39 [161196] (1 species)
  7. 893800Species Human (Homo sapiens) [TaxId:9606] [161197] (2 PDB entries)
    Uniprot Q9HCM9 104-143
  8. 893802Domain d2difa1: 2dif A:8-47 [146523]
    automatically matched to 2DID A:8-47
    complexed with zn

Details for d2difa1

PDB Entry: 2dif (more details)

PDB Description: one sequence two fold ? : miss fold of the zf-b-box domain from human tripartite motif protein 39
PDB Compounds: (A:) Tripartite motif protein 39

SCOP Domain Sequences for d2difa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2difa1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]}
eslcpqhhealslfcyedqeavclicaishthrahtvvpl

SCOP Domain Coordinates for d2difa1:

Click to download the PDB-style file with coordinates for d2difa1.
(The format of our PDB-style files is described here.)

Timeline for d2difa1: