![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) ![]() |
![]() | Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins) |
![]() | Protein Tripartite motif-containing protein 39 [161196] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161197] (2 PDB entries) Uniprot Q9HCM9 104-143 |
![]() | Domain d2dida1: 2did A:8-47 [146522] Other proteins in same PDB: d2dida2, d2dida3 complexed with zn |
PDB Entry: 2did (more details)
SCOPe Domain Sequences for d2dida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} eslcpqhhealslfcyedqeavclicaishthrahtvvpl
Timeline for d2dida1: