Lineage for d2dida1 (2did A:8-47)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037487Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 3037488Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 3037489Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 3037502Protein Tripartite motif-containing protein 39 [161196] (1 species)
  7. 3037503Species Human (Homo sapiens) [TaxId:9606] [161197] (2 PDB entries)
    Uniprot Q9HCM9 104-143
  8. 3037505Domain d2dida1: 2did A:8-47 [146522]
    Other proteins in same PDB: d2dida2, d2dida3
    complexed with zn

Details for d2dida1

PDB Entry: 2did (more details)

PDB Description: one sequence two fold ? : correct fold of the zf-b-box domain from human tripartite motif protein 39
PDB Compounds: (A:) Tripartite motif protein 39

SCOPe Domain Sequences for d2dida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]}
eslcpqhhealslfcyedqeavclicaishthrahtvvpl

SCOPe Domain Coordinates for d2dida1:

Click to download the PDB-style file with coordinates for d2dida1.
(The format of our PDB-style files is described here.)

Timeline for d2dida1: