![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224847] (3 PDB entries) |
![]() | Domain d2dfsp1: 2dfs P:10-148 [146518] automatically matched to d2bbma_ |
PDB Entry: 2dfs (more details), 24 Å
SCOPe Domain Sequences for d2dfsp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dfsp1 a.39.1.5 (P:10-148) Calmodulin {Mouse (Mus musculus) [TaxId: 10090]} aefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidfpefl tmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemiread idgdgqvnyeefvqmmtak
Timeline for d2dfsp1: