![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.2: Dodecin-like [89807] (1 family) ![]() |
![]() | Family d.230.2.1: Dodecin-like [89808] (2 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name |
![]() | Protein Uncharacterized protein TTHA1431 [159869] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159870] (8 PDB entries) Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68 |
![]() | Domain d2deva1: 2dev A:2-68 [146504] automatically matched to 2CZ8 A:2-68 complexed with cl, cs, na |
PDB Entry: 2dev (more details), 2.45 Å
SCOP Domain Sequences for d2deva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2deva1 d.230.2.1 (A:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle vgfrlee
Timeline for d2deva1: