Lineage for d2deva_ (2dev A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008036Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 3008046Protein automated matches [190247] (4 species)
    not a true protein
  7. 3008118Species Thermus thermophilus [TaxId:274] [187616] (3 PDB entries)
  8. 3008131Domain d2deva_: 2dev A: [146504]
    automated match to d2cz8a1
    complexed with cl, cs, na

Details for d2deva_

PDB Entry: 2dev (more details), 2.45 Å

PDB Description: Crystal structure of tt0972 protein from Thermus Thermophilus with Cs(+) ions
PDB Compounds: (A:) tt0972 protein

SCOPe Domain Sequences for d2deva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deva_ d.230.2.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrleet

SCOPe Domain Coordinates for d2deva_:

Click to download the PDB-style file with coordinates for d2deva_.
(The format of our PDB-style files is described here.)

Timeline for d2deva_: