SCOP 1.75: Domain d2degd1: 2deg D:2-68

Lineage for d2degd1 (2deg D:2-68)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.2: Dodecin-like [89807] (1 family)

5. Family d.230.2.1: Dodecin-like [89808] (2 proteins)
   Subunit assembly and a probable biological unit is a dodecamer, hence the name

6. Protein Uncharacterized protein TTHA1431 [159869] (1 species)

7. Species Thermus thermophilus [TaxId:274] [159870] (8 PDB entries)
   Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68

8. Domain d2degd1: 2deg D:2-68 [146495]
   automatically matched to 2CZ8 A:2-68
   complexed with gol, mn, na

Details for d2degd1

PDB Entry: 2deg, 1.7 Å

PDB Description: Crystal structure of tt0972 protein form Thermus Thermophilus with Mn2(+) ions

PDB Compounds: (D:) tt0972 protein

SCOP Domain Sequences for d2degd1:

Sequence; same for both SEQRES and ATOM records:

>d2degd1 d.230.2.1 (D:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrlee

Timeline for d2degd1:

• d2degd1 is new in SCOP 1.75
  
• d2degd1 is called d2degd_ in SCOPe 2.01
  
• d2degd1 appears in the current release, SCOPe 2.08, called d2degd_