Lineage for d2degc1 (2deg C:2-68)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881009Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 881030Superfamily d.230.2: Dodecin-like [89807] (1 family) (S)
  5. 881031Family d.230.2.1: Dodecin-like [89808] (2 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
  6. 881046Protein Uncharacterized protein TTHA1431 [159869] (1 species)
  7. 881047Species Thermus thermophilus [TaxId:274] [159870] (8 PDB entries)
    Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68
  8. 881064Domain d2degc1: 2deg C:2-68 [146494]
    automatically matched to 2CZ8 A:2-68
    complexed with gol, mn, na

Details for d2degc1

PDB Entry: 2deg (more details), 1.7 Å

PDB Description: Crystal structure of tt0972 protein form Thermus Thermophilus with Mn2(+) ions
PDB Compounds: (C:) tt0972 protein

SCOP Domain Sequences for d2degc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2degc1 d.230.2.1 (C:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrlee

SCOP Domain Coordinates for d2degc1:

Click to download the PDB-style file with coordinates for d2degc1.
(The format of our PDB-style files is described here.)

Timeline for d2degc1: