Lineage for d2ddzf_ (2ddz F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208925Family d.104.1.4: PH0223-like [160611] (1 protein)
    Pfam PF04017; DUF366
  6. 2208926Protein Uncharacterized protein PH0223 [160612] (1 species)
  7. 2208927Species Pyrococcus horikoshii [TaxId:53953] [160613] (1 PDB entry)
    Uniprot O57962 3-190
  8. 2208933Domain d2ddzf_: 2ddz F: [146491]
    automated match to d2ddza1
    complexed with gai, gol

Details for d2ddzf_

PDB Entry: 2ddz (more details), 2.24 Å

PDB Description: Protein of Unknown Function from Pyrococcus horikoshi
PDB Compounds: (F:) 190aa long hypothetical protein

SCOPe Domain Sequences for d2ddzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddzf_ d.104.1.4 (F:) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]}
smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
slkvrwvt

SCOPe Domain Coordinates for d2ddzf_:

Click to download the PDB-style file with coordinates for d2ddzf_.
(The format of our PDB-style files is described here.)

Timeline for d2ddzf_: