Lineage for d2ddze_ (2ddz E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036802Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1036803Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1037092Family d.104.1.4: PH0223-like [160611] (1 protein)
    Pfam PF04017; DUF366
  6. 1037093Protein Uncharacterized protein PH0223 [160612] (1 species)
  7. 1037094Species Pyrococcus horikoshii [TaxId:53953] [160613] (1 PDB entry)
    Uniprot O57962 3-190
  8. 1037099Domain d2ddze_: 2ddz E: [146490]
    automated match to d2ddza1
    complexed with gai, gol

Details for d2ddze_

PDB Entry: 2ddz (more details), 2.24 Å

PDB Description: Protein of Unknown Function from Pyrococcus horikoshi
PDB Compounds: (E:) 190aa long hypothetical protein

SCOPe Domain Sequences for d2ddze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddze_ d.104.1.4 (E:) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]}
mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
kdslkvrwvt

SCOPe Domain Coordinates for d2ddze_:

Click to download the PDB-style file with coordinates for d2ddze_.
(The format of our PDB-style files is described here.)

Timeline for d2ddze_: