Lineage for d2ddzc_ (2ddz C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574622Family d.104.1.4: PH0223-like [160611] (1 protein)
    Pfam PF04017; DUF366
  6. 2574623Protein Uncharacterized protein PH0223 [160612] (1 species)
  7. 2574624Species Pyrococcus horikoshii [TaxId:53953] [160613] (1 PDB entry)
    Uniprot O57962 3-190
  8. 2574627Domain d2ddzc_: 2ddz C: [146488]
    automated match to d2ddza1
    complexed with gai, gol

Details for d2ddzc_

PDB Entry: 2ddz (more details), 2.24 Å

PDB Description: Protein of Unknown Function from Pyrococcus horikoshi
PDB Compounds: (C:) 190aa long hypothetical protein

SCOPe Domain Sequences for d2ddzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddzc_ d.104.1.4 (C:) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]}
smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
slkvrwvt

SCOPe Domain Coordinates for d2ddzc_:

Click to download the PDB-style file with coordinates for d2ddzc_.
(The format of our PDB-style files is described here.)

Timeline for d2ddzc_: