Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.4: PH0223-like [160611] (1 protein) Pfam PF04017; DUF366 |
Protein Uncharacterized protein PH0223 [160612] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [160613] (1 PDB entry) Uniprot O57962 3-190 |
Domain d2ddzb_: 2ddz B: [146487] automated match to d2ddza1 complexed with gai, gol |
PDB Entry: 2ddz (more details), 2.24 Å
SCOPe Domain Sequences for d2ddzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddzb_ d.104.1.4 (B:) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]} smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd slkvrwvt
Timeline for d2ddzb_: