Lineage for d2ddza1 (2ddz A:3-190)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869892Family d.104.1.4: PH0223-like [160611] (1 protein)
    Pfam PF04017; DUF366
  6. 869893Protein Uncharacterized protein PH0223 [160612] (1 species)
  7. 869894Species Pyrococcus horikoshii [TaxId:53953] [160613] (1 PDB entry)
    Uniprot O57962 3-190
  8. 869895Domain d2ddza1: 2ddz A:3-190 [146486]
    complexed with gai, gol

Details for d2ddza1

PDB Entry: 2ddz (more details), 2.24 Å

PDB Description: Protein of Unknown Function from Pyrococcus horikoshi
PDB Compounds: (A:) 190aa long hypothetical protein

SCOP Domain Sequences for d2ddza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddza1 d.104.1.4 (A:3-190) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]}
smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
slkvrwvt

SCOP Domain Coordinates for d2ddza1:

Click to download the PDB-style file with coordinates for d2ddza1.
(The format of our PDB-style files is described here.)

Timeline for d2ddza1: