Lineage for d2dcfa1 (2dcf A:5-392)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618352Protein 6-aminohexanoate-dimer hydrolase NylC [160972] (1 species)
    NylB'
  7. 2618353Species Flavobacterium sp. [TaxId:239] [160973] (11 PDB entries)
    Uniprot P07062 5-392
  8. 2618354Domain d2dcfa1: 2dcf A:5-392 [146485]
    complexed with aca, gol, mes, so4; mutant

Details for d2dcfa1

PDB Entry: 2dcf (more details), 1.4 Å

PDB Description: crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/h266n mutant with substrate
PDB Compounds: (A:) 6-aminohexanoate-dimer hydrolase

SCOPe Domain Sequences for d2dcfa1:

Sequence, based on SEQRES records: (download)

>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]}
stgqhparypgaaageptldswqepphnrwafahlgemvpsaavsrrpvnapghalarlg
aiaaqlpdleqrleqtytdaflvlrgtevvaeyyragfapddrhllmavskslcgtvvga
lvdegridpaqpvteyvpelagsvydgpsvlqvldmqisidynedyvdpasevqthdrsa
gwrtrrhgdpadtyeflttlrgdgstgefqycsantdvlawivervtglryvealstylw
akldadrdatitvdttgfgfanggvsctardlarvgrmmldggvapggrvvsedwvrrvl
aggsheamtdkgftntfpdgsytrqwwctgnergnvsgigihgqnlwldpltdsvivkls
swpdpdtehwhrlqngilldvsraldav

Sequence, based on observed residues (ATOM records): (download)

>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]}
stgqhparypgaaageptldswqepphnrwafahlgemvpsaavsrrpghalarlgaiaa
qlpdleqrleqtytdaflvlrgtevvaeyyragfapddrhllmavskslcgtvvgalvde
gridpaqpvteyvpelagsvydgpsvlqvldmqisidynedyvdpasevqthdrsagwrt
rrhgdpadtyeflttlrgdgstgefqycsantdvlawivervtglryvealstylwakld
adrdatitvdttgfgfanggvsctardlarvgrmmldggvapggrvvsedwvrrvlaggs
heamtdkgftntfpdgsytrqwwctgnergnvsgigihgqnlwldpltdsvivklsswpd
pdtehwhrlqngilldvsraldav

SCOPe Domain Coordinates for d2dcfa1:

Click to download the PDB-style file with coordinates for d2dcfa1.
(The format of our PDB-style files is described here.)

Timeline for d2dcfa1: