Lineage for d2db9a1 (2db9 A:8-143)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797346Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
  5. 797347Family b.34.21.1: Plus3 [159043] (1 protein)
    Pfam PF03126
  6. 797348Protein RNA polymerase-associated protein RTF1 homolog [159044] (1 species)
  7. 797349Species Human (Homo sapiens) [TaxId:9606] [159045] (2 PDB entries)
    Uniprot Q92541 307-442! Uniprot Q92541 313-444
  8. 797351Domain d2db9a1: 2db9 A:8-143 [146482]

Details for d2db9a1

PDB Entry: 2db9 (more details)

PDB Description: solution structure of the plus-3 domain of human kiaa0252 protein
PDB Compounds: (A:) Paf1/RNA polymerase II complex component

SCOP Domain Sequences for d2db9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2db9a1 b.34.21.1 (A:8-143) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
ppksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeit
gvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmql
ptldeinkkelsikea

SCOP Domain Coordinates for d2db9a1:

Click to download the PDB-style file with coordinates for d2db9a1.
(The format of our PDB-style files is described here.)

Timeline for d2db9a1: