Lineage for d2db9a1 (2db9 A:8-143)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785340Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
    automatically mapped to Pfam PF03126
  5. 2785341Family b.34.21.1: Plus3 [159043] (2 proteins)
    Pfam PF03126
  6. 2785342Protein RNA polymerase-associated protein RTF1 homolog [159044] (1 species)
  7. 2785343Species Human (Homo sapiens) [TaxId:9606] [159045] (3 PDB entries)
    Uniprot Q92541 307-442! Uniprot Q92541 313-444
  8. 2785347Domain d2db9a1: 2db9 A:8-143 [146482]
    Other proteins in same PDB: d2db9a2, d2db9a3

Details for d2db9a1

PDB Entry: 2db9 (more details)

PDB Description: solution structure of the plus-3 domain of human kiaa0252 protein
PDB Compounds: (A:) Paf1/RNA polymerase II complex component

SCOPe Domain Sequences for d2db9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2db9a1 b.34.21.1 (A:8-143) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
ppksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeit
gvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmql
ptldeinkkelsikea

SCOPe Domain Coordinates for d2db9a1:

Click to download the PDB-style file with coordinates for d2db9a1.
(The format of our PDB-style files is described here.)

Timeline for d2db9a1: