SCOPe 2.08: Domain d2db7b2: 2db7 B:3-57

Lineage for d2db7b2 (2db7 B:3-57)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.273: Orange domain-like [158456] (1 superfamily)
   4 helices; dimer of identical alpha-hairpin subunits;

4. Superfamily a.273.1: Orange domain-like [158457] (1 family)

5. Family a.273.1.1: Hairy Orange domain [158458] (2 proteins)
   Pfam PF07527

6. Protein automated matches [190595] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187611] (1 PDB entry)

8. Domain d2db7b2: 2db7 B:3-57 [146481]
   Other proteins in same PDB: d2db7a1, d2db7a2, d2db7b3
   automated match to d2db7a1

Details for d2db7b2

PDB Entry: 2db7, 1.9 Å

PDB Description: Crystal structure of hypothetical protein MS0332

PDB Compounds: (B:) Hairy/enhancer-of-split related with YRPW motif 1

SCOPe Domain Sequences for d2db7b2:

Sequence; same for both SEQRES and ATOM records:

>d2db7b2 a.273.1.1 (B:3-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr

Timeline for d2db7b2:

• d2db7b2 first appeared in SCOP 1.75, called d2db7b1
  
• d2db7b2 appears in SCOPe 2.07