| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.273: Orange domain-like [158456] (1 superfamily) 4 helices; dimer of identical alpha-hairpin subunits; |
Superfamily a.273.1: Orange domain-like [158457] (1 family) ![]() |
| Family a.273.1.1: Hairy Orange domain [158458] (2 proteins) Pfam PF07527 |
| Protein automated matches [190595] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187611] (1 PDB entry) |
| Domain d2db7b2: 2db7 B:3-57 [146481] Other proteins in same PDB: d2db7a1, d2db7a2, d2db7b3 automated match to d2db7a1 |
PDB Entry: 2db7 (more details), 1.9 Å
SCOPe Domain Sequences for d2db7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2db7b2 a.273.1.1 (B:3-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr
Timeline for d2db7b2: