SCOPe 2.06: Domain d2db7a1: 2db7 A:3-57

Lineage for d2db7a1 (2db7 A:3-57)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.273: Orange domain-like [158456] (1 superfamily)
   4 helices; dimer of identical alpha-hairpin subunits;

4. Superfamily a.273.1: Orange domain-like [158457] (1 family)

5. Family a.273.1.1: Hairy Orange domain [158458] (2 proteins)
   Pfam PF07527

6. Protein Hairy/enhancer-of-split related with YRPW motif protein 1; HESR-1 [158459] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158460] (1 PDB entry)
   Uniprot Q9Y5J3 111-165

8. Domain d2db7a1: 2db7 A:3-57 [146480]
   Other proteins in same PDB: d2db7a2, d2db7b2, d2db7b3

Details for d2db7a1

PDB Entry: 2db7, 1.9 Å

PDB Description: Crystal structure of hypothetical protein MS0332

PDB Compounds: (A:) Hairy/enhancer-of-split related with YRPW motif 1

SCOPe Domain Sequences for d2db7a1:

Sequence; same for both SEQRES and ATOM records:

>d2db7a1 a.273.1.1 (A:3-57) Hairy/enhancer-of-split related with YRPW motif protein 1; HESR-1 {Human (Homo sapiens) [TaxId: 9606]}
gyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr

Timeline for d2db7a1:

• d2db7a1 first appeared in SCOP 1.75
  
• d2db7a1 appears in SCOPe 2.05
  
• d2db7a1 appears in SCOPe 2.07
  
• d2db7a1 appears in the current release, SCOPe 2.08