| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.3: RWD domain [110843] (4 proteins) Pfam PF05773 |
| Protein Uncharacterized protein C21orf6 [160083] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [160084] (1 PDB entry) Uniprot P57060 34-173 |
| Domain d2daxa1: 2dax A:8-146 [146478] Other proteins in same PDB: d2daxa2, d2daxa3 |
PDB Entry: 2dax (more details)
SCOPe Domain Sequences for d2daxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2daxa1 d.20.1.3 (A:8-146) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]}
eqaeaqlaeldllasmfpgenelivndqlavaelkdciekktmegrsskvyftinmnldv
sdekmamfslacilpfkypavlpeitvrsvllsrsqqtqlntdltaflqkhchgdvciln
atewvrehasgyvsrdtss
Timeline for d2daxa1: