Lineage for d2daxa1 (2dax A:8-146)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184206Family d.20.1.3: RWD domain [110843] (4 proteins)
    Pfam PF05773
  6. 2184217Protein Uncharacterized protein C21orf6 [160083] (1 species)
  7. 2184218Species Human (Homo sapiens) [TaxId:9606] [160084] (1 PDB entry)
    Uniprot P57060 34-173
  8. 2184219Domain d2daxa1: 2dax A:8-146 [146478]
    Other proteins in same PDB: d2daxa2, d2daxa3

Details for d2daxa1

PDB Entry: 2dax (more details)

PDB Description: solution structure of the rwd domain of human protein c21orf6
PDB Compounds: (A:) Protein C21orf6

SCOPe Domain Sequences for d2daxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daxa1 d.20.1.3 (A:8-146) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]}
eqaeaqlaeldllasmfpgenelivndqlavaelkdciekktmegrsskvyftinmnldv
sdekmamfslacilpfkypavlpeitvrsvllsrsqqtqlntdltaflqkhchgdvciln
atewvrehasgyvsrdtss

SCOPe Domain Coordinates for d2daxa1:

Click to download the PDB-style file with coordinates for d2daxa1.
(The format of our PDB-style files is described here.)

Timeline for d2daxa1: