Lineage for d2daxa1 (2dax A:8-147)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857200Family d.20.1.3: RWD domain [110843] (4 proteins)
    Pfam PF05773
  6. 857211Protein Uncharacterized protein C21orf6 [160083] (1 species)
  7. 857212Species Human (Homo sapiens) [TaxId:9606] [160084] (1 PDB entry)
    Uniprot P57060 34-173
  8. 857213Domain d2daxa1: 2dax A:8-147 [146478]

Details for d2daxa1

PDB Entry: 2dax (more details)

PDB Description: solution structure of the rwd domain of human protein c21orf6
PDB Compounds: (A:) Protein C21orf6

SCOP Domain Sequences for d2daxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]}
eqaeaqlaeldllasmfpgenelivndqlavaelkdciekktmegrsskvyftinmnldv
sdekmamfslacilpfkypavlpeitvrsvllsrsqqtqlntdltaflqkhchgdvciln
atewvrehasgyvsrdtsss

SCOP Domain Coordinates for d2daxa1:

Click to download the PDB-style file with coordinates for d2daxa1.
(The format of our PDB-style files is described here.)

Timeline for d2daxa1: