Lineage for d2dasa1 (2das A:8-56)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262778Family g.39.1.17: TRASH domain [161166] (1 protein)
    SMART 00746
  6. 2262779Protein Zinc finger MYM-type protein 5 [161167] (1 species)
  7. 2262780Species Human (Homo sapiens) [TaxId:9606] [161168] (1 PDB entry)
    Uniprot Q9UJ78 229-277
  8. 2262781Domain d2dasa1: 2das A:8-56 [146476]
    Other proteins in same PDB: d2dasa2, d2dasa3
    complexed with zn

Details for d2dasa1

PDB Entry: 2das (more details)

PDB Description: solution structure of trash domain of zinc finger mym-type protein 5
PDB Compounds: (A:) Zinc finger MYM-type protein 5

SCOPe Domain Sequences for d2dasa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dasa1 g.39.1.17 (A:8-56) Zinc finger MYM-type protein 5 {Human (Homo sapiens) [TaxId: 9606]}
qptaqqqltkpakitcanckkplqkgqtayqrkgsahlfcsttclssfs

SCOPe Domain Coordinates for d2dasa1:

Click to download the PDB-style file with coordinates for d2dasa1.
(The format of our PDB-style files is described here.)

Timeline for d2dasa1: