Lineage for d2d8va1 (2d8v A:8-61)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893784Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 893785Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) (S)
  5. 893786Family g.43.1.1: B-box zinc-binding domain [57846] (7 proteins)
  6. 893806Protein Zinc finger FYVE domain-containing protein 19 [161200] (1 species)
  7. 893807Species Mouse (Mus musculus) [TaxId:10090] [161201] (1 PDB entry)
    Uniprot Q9DAZ9 336-389
  8. 893808Domain d2d8va1: 2d8v A:8-61 [146474]
    complexed with zn

Details for d2d8va1

PDB Entry: 2d8v (more details)

PDB Description: solution structure of the b-box domain of the zinc finger fyve domain- containing protein 19 from mus musculus
PDB Compounds: (A:) Zinc finger FYVE domain-containing protein 19

SCOP Domain Sequences for d2d8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8va1 g.43.1.1 (A:8-61) Zinc finger FYVE domain-containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]}
lpwccicnedatlrcagcdgdlycarcfreghdnfdlkehqtspyhprrpcqeh

SCOP Domain Coordinates for d2d8va1:

Click to download the PDB-style file with coordinates for d2d8va1.
(The format of our PDB-style files is described here.)

Timeline for d2d8va1: