![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) ![]() |
![]() | Family g.43.1.1: B-box zinc-binding domain [57846] (7 proteins) |
![]() | Protein Zinc finger FYVE domain-containing protein 19 [161200] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [161201] (1 PDB entry) Uniprot Q9DAZ9 336-389 |
![]() | Domain d2d8va1: 2d8v A:8-61 [146474] complexed with zn |
PDB Entry: 2d8v (more details)
SCOP Domain Sequences for d2d8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8va1 g.43.1.1 (A:8-61) Zinc finger FYVE domain-containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} lpwccicnedatlrcagcdgdlycarcfreghdnfdlkehqtspyhprrpcqeh
Timeline for d2d8va1: