Lineage for d2d81a1 (2d81 A:21-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901801Family c.69.1.37: PHB depolymerase-like [159747] (1 protein)
  6. 2901802Protein Polyhydroxybutyrate depolymerase [159748] (1 species)
  7. 2901803Species Penicillium funiculosum [TaxId:28572] [159749] (2 PDB entries)
  8. 2901804Domain d2d81a1: 2d81 A:21-338 [146471]
    complexed with nag, rb3

Details for d2d81a1

PDB Entry: 2d81 (more details), 1.66 Å

PDB Description: phb depolymerase (s39a) complexed with r3hb trimer
PDB Compounds: (A:) PHB depolymerase

SCOPe Domain Sequences for d2d81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]}
talpafnvnpnsvsvsglasggymaaqlgvaysdvfnvgfgvfaggpydcarnqyytscm
yngypsittptanmkswsgnqiasvanlgqrkiymwtgssdttvgpnvmnqlkaqlgnfd
nsanvsyvtttgavhtfptdfngagdnscslstspyisncnydgagaalkwiygslnarn
tgtlsgsvlsfaqsgsygangmdttgylyvpqscasgatvcslhvalhgclqsyssigsr
fiqntgynkwadtnnmiilypqaipdytihaiwnggvlsnpngcwdwvgwygsnadqigg
vqmaaivgqvkqivsgfq

SCOPe Domain Coordinates for d2d81a1:

Click to download the PDB-style file with coordinates for d2d81a1.
(The format of our PDB-style files is described here.)

Timeline for d2d81a1: