Lineage for d2d7vb_ (2d7v B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007847Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 3007871Protein Hypothetical protein VCA0330 [160787] (1 species)
  7. 3007872Species Vibrio cholerae [TaxId:666] [160788] (1 PDB entry)
    Uniprot Q9KMK9 7-161
  8. 3007874Domain d2d7vb_: 2d7v B: [146469]
    automated match to d2d7va1

Details for d2d7vb_

PDB Entry: 2d7v (more details), 1.97 Å

PDB Description: Structure of OsmC-like Protein of Unknown Function VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (B:) Hypothetical protein VCA0330

SCOPe Domain Sequences for d2d7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7vb_ d.227.1.1 (B:) Hypothetical protein VCA0330 {Vibrio cholerae [TaxId: 666]}
msehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpee
afvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsgt
skptlqqlekmhhlahencfiansvetevvteii

SCOPe Domain Coordinates for d2d7vb_:

Click to download the PDB-style file with coordinates for d2d7vb_.
(The format of our PDB-style files is described here.)

Timeline for d2d7vb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d7va1