SCOP 1.75: Domain d2d7va1: 2d7v A:7-161

Lineage for d2d7va1 (2d7v A:7-161)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (2 families)

5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (7 proteins)

6. Protein Hypothetical protein VCA0330 [160787] (1 species)

7. Species Vibrio cholerae [TaxId:666] [160788] (1 PDB entry)
   Uniprot Q9KMK9 7-161

8. Domain d2d7va1: 2d7v A:7-161 [146468]

Details for d2d7va1

PDB Entry: 2d7v, 1.97 Å

PDB Description: Structure of OsmC-like Protein of Unknown Function VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961

PDB Compounds: (A:) Hypothetical protein VCA0330

SCOP Domain Sequences for d2d7va1:

Sequence; same for both SEQRES and ATOM records:

>d2d7va1 d.227.1.1 (A:7-161) Hypothetical protein VCA0330 {Vibrio cholerae [TaxId: 666]}
smsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpe
eafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsg
tskptlqqlekmhhlahencfiansvetevvteii

Timeline for d2d7va1:

• d2d7va1 is new in SCOP 1.75
  
• d2d7va1 appears in SCOPe 2.01
  
• d2d7va1 appears in the current release, SCOPe 2.08