![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
![]() | Superfamily d.227.1: OsmC-like [82784] (3 families) ![]() |
![]() | Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
![]() | Protein Hypothetical protein VCA0330 [160787] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [160788] (1 PDB entry) Uniprot Q9KMK9 7-161 |
![]() | Domain d2d7va1: 2d7v A:7-161 [146468] |
PDB Entry: 2d7v (more details), 1.97 Å
SCOPe Domain Sequences for d2d7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7va1 d.227.1.1 (A:7-161) Hypothetical protein VCA0330 {Vibrio cholerae [TaxId: 666]} smsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpe eafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsg tskptlqqlekmhhlahencfiansvetevvteii
Timeline for d2d7va1: