Lineage for d2d5ra1 (2d5r A:11-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886966Family c.55.3.9: CAF1-like ribonuclease [102492] (3 proteins)
  6. 2886967Protein CCR4-NOT transcription complex subunit 7, CAF1 [159633] (1 species)
  7. 2886968Species Human (Homo sapiens) [TaxId:9606] [159634] (1 PDB entry)
    Uniprot Q9UIV1 11-262
  8. 2886969Domain d2d5ra1: 2d5r A:11-262 [146466]
    Other proteins in same PDB: d2d5rb1, d2d5rb2

Details for d2d5ra1

PDB Entry: 2d5r (more details), 2.5 Å

PDB Description: Crystal Structure of a Tob-hCaf1 Complex
PDB Compounds: (A:) CCR4-NOT transcription complex subunit 7

SCOPe Domain Sequences for d2d5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]}
ricevwacnldeemkkirqvirkynyvamdtefpgvvarpigefrsnadyqyqllrcnvd
llkiiqlgltfmneqgeyppgtstwqfnfkfnltedmyaqdsiellttsgiqfkkheeeg
ietqyfaellmtsgvvlcegvkwlsfhsgydfgylikiltnsnlpeeeldffeilrlffp
viydvkylmkscknlkgglqevaeqlelerigpqhqagsdslltgmaffkmremffedhi
ddakycghlygl

SCOPe Domain Coordinates for d2d5ra1:

Click to download the PDB-style file with coordinates for d2d5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ra1: