SCOPe 2.04: Domain d2d5gd1: 2d5g D:750-832

Lineage for d2d5gd1 (2d5g D:750-832)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.8: DIX domain [159926] (1 protein)
   Pfam PF00778

6. Protein Axin 1 [159927] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
   Uniprot O70239 745-827

8. Domain d2d5gd1: 2d5g D:750-832 [146463]
   automatically matched to 2D5G A:750-832
   complexed with hg; mutant

Details for d2d5gd1

PDB Entry: 2d5g, 3.2 Å

PDB Description: structure of ubiquitin fold protein r767e mutant

PDB Compounds: (D:) Axin-1

SCOPe Domain Sequences for d2d5gd1:

Sequence; same for both SEQRES and ATOM records:

>d2d5gd1 d.15.1.8 (D:750-832) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
vredeailpvfeekiigkvekvd

Timeline for d2d5gd1:

• d2d5gd1 first appeared in SCOP 1.75
  
• d2d5gd1 appears in SCOPe 2.03
  
• d2d5gd1 appears in SCOPe 2.05
  
• d2d5gd1 appears in the current release, SCOPe 2.08