Lineage for d2d5gd1 (2d5g D:750-832)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933068Family d.15.1.8: DIX domain [159926] (2 proteins)
    Pfam PF00778
  6. 2933069Protein Axin 1 [159927] (1 species)
  7. 2933070Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
    Uniprot O70239 745-827
  8. 2933077Domain d2d5gd1: 2d5g D:750-832 [146463]
    automatically matched to 2D5G A:750-832
    complexed with hg; mutant

Details for d2d5gd1

PDB Entry: 2d5g (more details), 3.2 Å

PDB Description: structure of ubiquitin fold protein r767e mutant
PDB Compounds: (D:) Axin-1

SCOPe Domain Sequences for d2d5gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5gd1 d.15.1.8 (D:750-832) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
vredeailpvfeekiigkvekvd

SCOPe Domain Coordinates for d2d5gd1:

Click to download the PDB-style file with coordinates for d2d5gd1.
(The format of our PDB-style files is described here.)

Timeline for d2d5gd1: