Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.8: DIX domain [159926] (2 proteins) Pfam PF00778 |
Protein Axin 1 [159927] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries) Uniprot O70239 745-827 |
Domain d2d5gd1: 2d5g D:750-832 [146463] automatically matched to 2D5G A:750-832 complexed with hg; mutant |
PDB Entry: 2d5g (more details), 3.2 Å
SCOPe Domain Sequences for d2d5gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5gd1 d.15.1.8 (D:750-832) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} cdsivvayyfcgepipyetlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee vredeailpvfeekiigkvekvd
Timeline for d2d5gd1: