![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer |
![]() | Protein Gentisate 1,2-dioxygenase [159300] (3 species) Salicylate 1,2-dioxygenase |
![]() | Species Escherichia coli [TaxId:562] [159301] (1 PDB entry) Uniprot Q8X655 35-342 |
![]() | Domain d2d40d_: 2d40 D: [146457] automated match to d2d40a1 complexed with fe |
PDB Entry: 2d40 (more details), 2.41 Å
SCOPe Domain Sequences for d2d40d_:
Sequence, based on SEQRES records: (download)
>d2d40d_ b.82.1.23 (D:) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} pktpnancapaywnyqeirplllesggligakeavrrvlvlenpalrgqssitatlyagl qlimpgevapshrhnqsalrfivegkgaftavdgertpmnegdfiltpqwrwhdhgnpgd epviwldgldlplvnilgcgfaedypeeqqpvtrkegdylpryaanmlplrhqtgnsspi fnyrydrsrevlhdltrlgdadewdgykmryvnpvtggypmpsmgaflqllpkgfasrva rttdstiyhvvegsgqviignetfsfsakdifvvptwhgvsfqttqdsvlfsfsdrpvqe alglfreary
>d2d40d_ b.82.1.23 (D:) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} pktpnancapaywnyqeirlvlenpalrgqssitatlyaglqlimpgevapshrhnqsal rfivegkgaftavdgertpmnegdfiltpqwrwhdhgnpgdepviwldgldlplvnilgc gfaedyppvtrkegdylpryaanmlplrhqtgnsspifnyrydrsrevlhdltrlgdade wdgykmryvnpvtggypmpsmgaflqllpkgfasrvarttdstiyhvvegsgqviignet fsfsakdifvvptwhgvsfqttqdsvlfsfsdrpvqealglfreary
Timeline for d2d40d_: