Lineage for d2d40b_ (2d40 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070570Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer
  6. 2070571Protein Gentisate 1,2-dioxygenase [159300] (3 species)
    Salicylate 1,2-dioxygenase
  7. 2070572Species Escherichia coli [TaxId:562] [159301] (1 PDB entry)
    Uniprot Q8X655 35-342
  8. 2070574Domain d2d40b_: 2d40 B: [146455]
    automated match to d2d40a1
    complexed with fe

Details for d2d40b_

PDB Entry: 2d40 (more details), 2.41 Å

PDB Description: crystal structure of z3393 from escherichia coli o157:h7
PDB Compounds: (B:) putative gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d2d40b_:

Sequence, based on SEQRES records: (download)

>d2d40b_ b.82.1.23 (B:) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}
pnancapaywnyqeirplllesggligakeavrrvlvlenpalrgqssitatlyaglqli
mpgevapshrhnqsalrfivegkgaftavdgertpmnegdfiltpqwrwhdhgnpgdepv
iwldgldlplvnilgcgfaedypeeqqpvtrkegdylpryaanmlplrhqtgnsspifny
rydrsrevlhdltrlgdadewdgykmryvnpvtggypmpsmgaflqllpkgfasrvartt
dstiyhvvegsgqviignetfsfsakdifvvptwhgvsfqttqdsvlfsfsdrpvqealg
lfrear

Sequence, based on observed residues (ATOM records): (download)

>d2d40b_ b.82.1.23 (B:) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]}
pnancapaywnyqeirplvlenpalrgqssitatlyaglqlimpgevapshrhnqsalrf
ivegkgaftavdgertpmnegdfiltpqwrwhdhgnpgdepviwldgldlplvnilgcgf
aedyppvtrkegdylpryaanmlplrhqtgnsspifnyrydrsrevlhdltrlgdadewd
gykmryvnpvtggypmpsmgaflqllpkgfasrvarttdstiyhvvegsgqviignetfs
fsakdifvvptwhgvsfqttqdsvlfsfsdrpvqealglfrear

SCOPe Domain Coordinates for d2d40b_:

Click to download the PDB-style file with coordinates for d2d40b_.
(The format of our PDB-style files is described here.)

Timeline for d2d40b_: