Lineage for d2d3os1 (2d3o S:4-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783981Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2783982Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries)
    Uniprot Q9RXJ1 4-113
  8. 2783984Domain d2d3os1: 2d3o S:4-113 [146452]
    Other proteins in same PDB: d2d3or1, d2d3ow1
    automatically matched to 2ZJR R:4-113

Details for d2d3os1

PDB Entry: 2d3o (more details), 3.35 Å

PDB Description: structure of ribosome binding domain of the trigger factor on the 50s ribosomal subunit from d. radiodurans
PDB Compounds: (S:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2d3os1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3os1 b.34.5.1 (S:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt

SCOPe Domain Coordinates for d2d3os1:

Click to download the PDB-style file with coordinates for d2d3os1.
(The format of our PDB-style files is described here.)

Timeline for d2d3os1: