Lineage for d2d1ia1 (2d1i A:10-373)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155379Family d.3.1.22: Autophagin-like [159858] (3 protein domains)
    Pfam PF03416
  6. 2155386Protein Cysteine protease ATG4B [159861] (1 species)
    Autophagin-1
  7. 2155387Species Human (Homo sapiens) [TaxId:9606] [159862] (2 PDB entries)
    Uniprot Q9Y4P1 10-373! Uniprot Q9Y4P1 5-354
  8. 2155389Domain d2d1ia1: 2d1i A:10-373 [146447]

Details for d2d1ia1

PDB Entry: 2d1i (more details), 2 Å

PDB Description: Structure of human Atg4b
PDB Compounds: (A:) Cysteine protease APG4B

SCOPe Domain Sequences for d2d1ia1:

Sequence, based on SEQRES records: (download)

>d2d1ia1 d.3.1.22 (A:10-373) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]}
tlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggtgptsd
tgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyysihqia
qmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcrtsvpc
agatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetlkhcfmm
pqslgviggkpnsahyfigyvgeeliyldphttqpaveptdgcfipdesfhcqhppcrms
iaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveqqpshlacpdvlnlsl
dssd

Sequence, based on observed residues (ATOM records): (download)

>d2d1ia1 d.3.1.22 (A:10-373) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]}
tlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggtgptsd
tgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyysihqia
qmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcrtsvpc
apspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeel
iyldphttqpaveptdgcfipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcq
qvkklsllggalpmfelveqqpshlacpdvlnlsldssd

SCOPe Domain Coordinates for d2d1ia1:

Click to download the PDB-style file with coordinates for d2d1ia1.
(The format of our PDB-style files is described here.)

Timeline for d2d1ia1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d1ib_