Lineage for d2d00f_ (2d00 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886555Fold c.149: AtpF-like [159467] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1886556Superfamily c.149.1: AtpF-like [159468] (1 family) (S)
    automatically mapped to Pfam PF01990
  5. 1886557Family c.149.1.1: AtpF-like [159469] (2 proteins)
    Pfam PF01990; segment-swapping in some members
  6. 1886564Protein automated matches [190584] (1 species)
    not a true protein
  7. 1886565Species Thermus thermophilus [TaxId:274] [187591] (1 PDB entry)
  8. 1886570Domain d2d00f_: 2d00 F: [146446]
    Other proteins in same PDB: d2d00a1
    automated match to d2d00a1
    complexed with ca

Details for d2d00f_

PDB Entry: 2d00 (more details), 2.2 Å

PDB Description: Subunit F of V-type ATPase/synthase
PDB Compounds: (F:) V-type ATP synthase subunit F

SCOPe Domain Sequences for d2d00f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d00f_ c.149.1.1 (F:) automated matches {Thermus thermophilus [TaxId: 274]}
mvpvrmaviadpetaqgfrlaglegygassaeeaqslletlverggyalvavdeallpdp
eraverlmrgrdlpvllpiaglkeafqghdvegymrelvrktigfdikl

SCOPe Domain Coordinates for d2d00f_:

Click to download the PDB-style file with coordinates for d2d00f_.
(The format of our PDB-style files is described here.)

Timeline for d2d00f_: