SCOP 1.75: Domain d2d00f1: 2d00 F:6-109

Lineage for d2d00f1 (2d00 F:6-109)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.149: AtpF-like [159467] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.149.1: AtpF-like [159468] (1 family)

5. Family c.149.1.1: AtpF-like [159469] (1 protein)
   Pfam PF01990; segment-swapping in some members

6. Protein V-type ATP synthase subunit F, AtpF [159470] (2 species)

7. Species Thermus thermophilus [TaxId:274] [159471] (1 PDB entry)
   Uniprot P74903 1-104

8. Domain d2d00f1: 2d00 F:6-109 [146446]
   automatically matched to 2D00 A:6-109
   complexed with ca

Details for d2d00f1

PDB Entry: 2d00, 2.2 Å

PDB Description: Subunit F of V-type ATPase/synthase

PDB Compounds: (F:) V-type ATP synthase subunit F

SCOP Domain Sequences for d2d00f1:

Sequence; same for both SEQRES and ATOM records:

>d2d00f1 c.149.1.1 (F:6-109) V-type ATP synthase subunit F, AtpF {Thermus thermophilus [TaxId: 274]}
maviadpetaqgfrlaglegygassaeeaqslletlverggyalvavdeallpdperave
rlmrgrdlpvllpiaglkeafqghdvegymrelvrktigfdikl

Timeline for d2d00f1:

• d2d00f1 is new in SCOP 1.75
  
• d2d00f1 is called d2d00f_ in SCOPe 2.01
  
• d2d00f1 appears in the current release, SCOPe 2.08, called d2d00f2